X

Win 2019 Rugby World Cup Tickets When You Play at Games.Bitcoin.com

Are you a cryptocurrency user and rugby fan who’s always dreamed of going to the World Cup? Here’s your chance to win tickets to the 2019 Rugby World Cup in Japan, including flights and accommodation, in an exclusive competition at Games.Bitcoin.com.

Also Read: Bitcoin Cash ETP Lists on Leading Swiss Stock Exchange SIX

How to Enter Games.Bitcoin.com’s New Giveaway

Games.Bitcoin.com is giving away prizes including admission to the upcoming 2019 Rugby World Cup in Japan. The first couple of winners will receive a prize package that includes VIP hospitality tickets to the event’s quarter-final match, accommodation for three nights in a central Tokyo hotel, and $1,000 to purchase flight tickets from anywhere in the world to the land of the rising sun. The remaining top 16 places in the giveaway contest will also win nice prizes such as an official Japan 2019 World Cup rugby ball and jerseys as well as gaming credits.

The VIP hospitality tickets feature prime locations (exclusive Category A seats), pre and post-match analysis by guest speakers, food and drinks including specially selected fine wines and premium beers served throughout the match. The VIP ticket winners will also get an official Rugby World Cup 2019 match programme, itinerary, map, and a commemorative souvenir.

For your chance to win one of the Rugby World Cup prizes, play the BTC Slots on Games.Bitcoin.com and make your way to the top of the leaderboard by September 1, 2019. Every time you win a bet, your username will move higher up the real-time public score board displayed on the site. You will need to stay in one of the top 16 positions to score some of the above mentioned prizes at the end of the promotion period.

Notice that this new promotion is exclusive to BTC Slots and other games are excluded from the current giveaway. Check out the promotion page for the full terms and conditions that apply to the offer.

2019 Rugby World Cup in Japan

Hosted once every four years, the Rugby World Cup is the sport’s top global tournament and is considered to be the third largest sports event in the world after the summer Olympics and the Football World Cup. The 2019 Rugby World Cup will be the ninth edition of the showcase event, and is to be held in Japan from September 20 to November 2.

Taking part in the upcoming event will be 20 teams from all over the world including Argentina, Australia, Canada, England, Fiji, France, Georgia, Ireland, Italy, Japan, Namibia, New Zealand, Russia, Samoa, Scotland, South Africa, Tonga, Uruguay, the United States of America and Wales.

2019 Rugby World Cup Mascots in St Patrick’s Day Parade at Harajuku, Tokyo, Japan

The six-week tournament will be hosted in a dozen venues across Japan. The 2019 edition will be the first Rugby World Cup to be hosted in Asia and the organizers see it as an opportunity to accelerate the development and profile of the sport across the world’s most populous and youthful continent. In all, there will be 48 matches, potentially reaching hundreds of millions of viewers all over the globe.

An estimated $344 million has been invested between 2016 and 2019 around the world in the run up to the event. This figure includes funding of dedicated strategic investment programs to assist unions who have qualified for the Rugby World Cup, development projects, tournament funding and player welfare research and projects.

Anonymous Online Play

If this is your first time hearing about it, Bitcoin.com’s entertainment section offers a multitude of other classic games in addition to Slots, such as Blackjack, Video Poker, Dice, Roulette, Keno and Craps. Players don’t need to register and can enjoy the games anonymously. At the same time, the platform offers two-factor authentication, password protected accounts and a dedicated customer support team.

The site supports playing with bitcoin core (BTC ) on games.bitcoin.com and with bitcoin cash (BCH ) on the separate cashgames.bitcoin.com domain. Besides the two websites, you can also download a mobile app for Android devices and play on the go wherever you are, as well as use the same account on the website and the mobile app.

The entertainment section operates with transparency, showing the current house edge for all games and the expected returns to players. It also provides all of the information you need to verify that each game is fair and in no way manipulated so you can play with confidence. Check out the Provably Fair section in the ‘About’ tab of the game you are playing for more technical details.

The platform also provides a referral program that requires no registration and lets you earn up to 25% of the house edge on all bets made by people you direct to the site, with no top limit on how much you can earn. To join the referral program, all you have to do is visit the referral page and your account will be automatically set up. There you can find your unique referral link and banners in many shapes and sizes to share. The same page can also be used to track your earnings and referral statistics.

Are you excited about the opportunity to win tickets to the 2019 Rugby World Cup in Japan? Share your thoughts in the comments section below.


Images courtesy of Shutterstock.


Verify and track bitcoin cash transactions on our BCH Block Explorer , the best of its kind anywhere in the world. Also, keep up with your holdings, BCH and other coins, on our market charts at Bitcoin.com Markets , another original and free service from Bitcoin.com.

The post Win 2019 Rugby World Cup Tickets When You Play at Games.Bitcoin.com appeared first on Bitcoin News .

Categories: BTC Japan News
Tags: 10x500euro50dollarsadventureadventuresaffiliatemarketingaiaktiealtcoinaltcoinsanotherarbeitenballerbanknotebanknotesandcoinscollectorbccbchbefreebenjaminsbillbitcoinbitcoinacceptedherebitcoinbillionairebitcoincashbitcoinchartsbitcoinclubbitcoinerbitcoinexchangebitcoinmillionairebitcoinmillionairesbitcoinminingbitcoinnewsbitcoinpricebitcoinsbitcointechnologybitcointradebitcoinvaluebitcoinwalletbitconnectbittrexbiznisblockchainbossmovesbrokerbtcbubblebullbusinessbusiness6bussinessbuybuybitcoincarcashchainlinkchallengecoherencecoinbasecoinscollectorconcentrationconsultingcouragecreativitycryptocryptocurencycryptocurrenciescryptocurrencycryptominingcryptoscryptotradingcrytocurrencycurrencydailyinspirationdashdashcoindeltadigitaldigitalcoindigitalcurrencydigitalnomaddinerodollarsdreambigdreambiggereconomiaelectroneumenlightenedentrepreneurentrepreneurlifeentrepreneurshipentreprenuererfolgerfolgistkeinglückerfolgreichetcethetherethereumeurosevolutionexerciseexoticlifefinancefinancialintelligencefinanziellefreiheitfintechfirmfitnessfocusfomoforexforexlifestyleforexsignalsforextraderforextradingfreefreebitcoinfreedomfreedommovementfunfuturefuturogdaxgetinspiredgoalsgobiggoldgoodlifeclubgrowthgymhackhangsenghappinesshappyhealthhodlericoincomeindexindiespaceinitialcoinofferinginspiraciainspirationinstaquoteinternetmoneyinvestinvesticiainvestinbitcoininvestinginvestitioninvestmentinvestorinvestorsiotalamborghinilaptoplivinglawofattractionlegacylifeisgreatlifequotelifestylelitecoinlovelseltcluxuryluxurylifeluxurylifestylemarketsimillionairemillionaremindminermineriaminingmoneromoneymoneymakermoonmooningmotivacemotivaciamotivaciajezakladmotivationnemneonewnewbeginingsnewsnewstodayno9to5nowomgonlineincomepassiveincomeperseveranceperseverepersistencepokemonpoloniexportfoliopowerproductivitypurposequoteofthedayquotesrealestaterealestateagentrealestateinvestorrealityreichtumreichwerdenreitrichrippleripplesrocketsatoshisavingsellsexysharesslovakiaslovenskospiritualstartupsteemitstockstockbrokerstockholmstockmarketstocksstrategystratissuccesssuccessfullsuccessfullifesvktakeovertechtechnologytecnologiatetherthecomeupthesecretthoughtstothemoontradetraderstradingtradingforextransformationtraveltravellifetrumptrxusvaluableventuresvisionarywealthwillpowerworkfromhomeworkhardworkoutxemxrpzcashzilina
admin: